DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG4650

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:286 Identity:71/286 - (24%)
Similarity:120/286 - (41%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            ||.:|  .|:.|.|.| ..||   |..|.:..|::|.....|:...|...|   :...||.::|:
  Fly     8 ISALL--FLLPVPGSS-QYLD---GRCGLLTNGKIANNISSPWMAYLHTSE---LLYVCGGTVIT 63

  Fly    68 DRYLLTAAHCVEKAVAITYYLGGVL--------RLAPRQLIRSTNPEVHLHPDWNCQSLENDIAL 124
            ::.:||||||...:..:...:|..:        .|:..|:     .:..:|..:|..:..||||:
  Fly    64 EKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQV-----SQTFIHSLYNTTTSANDIAI 123

  Fly   125 VRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASG-WGRMNDESTAISDNLRYVYRFVESNED 188
            :.|..|.:...:||||.:...:..|...|.:..::.. ||..||.                 ||.
  Fly   124 LGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDR-----------------NES 171

  Fly   189 CEYSYANIK--PTNICMDTTG----GKSTCTGDSGGPLV---YSDPV------QNAD--ILIGVT 236
            ..:...:|:  |.|:|....|    ....|.|||...|.   :|.|:      :|..  :|||:.
  Fly   172 DAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIA 236

  Fly   237 SYGKKSGCTKGYPSVFTRITAYLDWI 262
            :..:|  |.:.  ||:|.:.::.|:|
  Fly   237 TTNQK--CKRA--SVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 59/256 (23%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 59/253 (23%)
Tryp_SPc 33..258 CDD:304450 59/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.