DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Phae1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:300 Identity:79/300 - (26%)
Similarity:122/300 - (40%) Gaps:99/300 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSISCLDMGHGIG---GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLL 72
            |:|:.|   .|...|..||   ||:.||..|..|..||.|.:.....:    :|.||:::..:|:
  Fly    15 LLLLLG---ICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTH----YCAASILNANWLV 72

  Fly    73 TAAHCVEK--------------AV----------AITY------YLGGVLRLAPRQLIRSTNPEV 107
            |||||:..              ||          :|||      |.||                 
  Fly    73 TAAHCLTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGG----------------- 120

  Fly   108 HLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVP---AIASGWGRMNDES 169
                     ::..||.::..|...:...::.|:.||       |...||   |...|||..:..:
  Fly   121 ---------TVPYDIGMIYTPTAFVWSAAVAPVTLP-------SSGVVPTGTANLYGWGSTSTTN 169

  Fly   170 TA-------ISDNLRYVYRFVESNEDCEYSY----ANIKPTNICM-DTTGGKSTCTGDSGGPLVY 222
            ||       ::.|:..:     |...||.:.    :::..||:|. ..|||.|.||.||||||| 
  Fly   170 TASYPSTLQVATNVPII-----SLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLV- 228

  Fly   223 SDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
                 ..::|||:.|:||........|||:.::::::.||
  Fly   229 -----QGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 69/275 (25%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 69/275 (25%)
Tryp_SPc 36..266 CDD:238113 69/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.