DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and TMPRSS7

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:262 Identity:78/262 - (29%)
Similarity:117/262 - (44%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHC---- 77
            ||.|.|.       ||.||.......:|:||.|.....    .:||||:||..:||:||||    
Human   598 RSSSALH-------RIIGGTDTLEGGWPWQVSLHFVGS----AYCGASVISREWLLSAAHCFHGN 651

  Fly    78 -VEKAVAITYYLGGVLR-----LAP-RQLIRSTNPEVHLHPDWNCQSLENDIALVRL----PEDA 131
             :......|.:||..::     ::| |:::        :|..:|.|:.:.||||::|    ||  
Human   652 RLSDPTPWTAHLGMYVQGNAKFVSPVRRIV--------VHEYYNSQTFDYDIALLQLSIAWPE-- 706

  Fly   132 LLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANI 196
            .|...|:||.:|.......|.:  ....:||||.::.....|..|:.....:.....|..:|..|
Human   707 TLKQLIQPICIPPTGQRVRSGE--KCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLCVSTYGII 769

  Fly   197 KPTNICMDTTGGK-STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLD 260
            ....:|.....|| ..|.|||||||..........||.|:.|:|..|| ...:|.|:||::.::.
Human   770 TSRMLCAGIMSGKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSG-RPNFPGVYTRVSNFVP 833

  Fly   261 WI 262
            ||
Human   834 WI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/246 (29%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.