DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and PRSS53

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:349 Identity:76/349 - (21%)
Similarity:122/349 - (34%) Gaps:121/349 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSI----------SCLDMGHG-----IGGRIAGGELARANQFPYQVGLSIEEPNDMYCW 60
            ::|:.|.::          :|...|.|     .|..:.|       ::|:|..:..:..:    .
Human     8 VLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPG-------EWPWQASVRRQGAH----I 61

  Fly    61 CGASLISDRYLLTAAHCVEKAVAI-----TYYLGGVLR-----------LAPRQLIRSTNPEVHL 109
            |..||::|.::||||||.|||.|.     :..||.:.|           :|..||.|:       
Human    62 CSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRA------- 119

  Fly   110 HPDWNCQSLENDIALVRLPEDAL---LCDSIRPIRLP-GLSSSRNSYDYVPAIASGWGRMN---- 166
               :|..|..:|:||::|.....   ||......|.| |.|.....:|...:....|.|:.    
Human   120 ---YNHYSQGSDLALLQLAHPTTHTPLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEA 181

  Fly   167 ---DESTAISDN---------------------------LRYVYRFVESNEDCEYSYANI----- 196
               ...|..:.|                           ||.:...:.|...|...|..:     
Human   182 LCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHL 246

  Fly   197 ----KPTNICMDTTGG-----KSTCTGDSGGPLVYSDP----VQNADILIGVTSYGKKSGCT-KG 247
                :|..:|    ||     :..|.||||||::..:|    ||     .|:.|:.  |.|. :.
Human   247 SNPARPGMLC----GGPQPGVQGPCQGDSGGPVLCLEPDGHWVQ-----AGIISFA--SSCAQED 300

  Fly   248 YPSVFTRITAYLDWI-GEVSGVHY 270
            .|.:.|...|:..|: ..|.|..:
Human   301 APVLLTNTAAHSSWLQARVQGAAF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/303 (22%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 68/305 (22%)
Tryp_SPc 43..314 CDD:214473 67/302 (22%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.