DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and prss60.3

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:288 Identity:91/288 - (31%)
Similarity:135/288 - (46%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLILVQGRSISCLDM-GHG-IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLL 72
            |||.|:| |:|.|:: |.. :..||.||..|....:|:||  |:..|.....:||.||||..::|
Zfish    13 LLICVKG-SLSQLNVCGQAPLNTRIVGGVNASPGSWPWQV--SLHSPKYGGHFCGGSLISSEWVL 74

  Fly    73 TAAHCVE--KAVAITYYLG-----GV-LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPE 129
            |||||:.  ....:..|||     |: :....|.:.:|     .:|..:|..:.:|||||:||..
Zfish    75 TAAHCLSGVSETTLVVYLGRRTQQGINIYETSRNVAKS-----FVHSSYNSNTNDNDIALLRLSS 134

  Fly   130 DALLCDSIRPIRLPGLSS--SRNSYDYVPAIASGWGRMND----------ESTAISDNLRYVYRF 182
            .....:.|||:.|...:|  |..:..::    :|||.:..          :.|.|.         
Zfish   135 AVTFTNYIRPVCLAAQNSVYSAGTSSWI----TGWGDIQAGVNLPAPGILQETMIP--------- 186

  Fly   183 VESNEDCEYSYANIKPTN--ICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC 244
            |.:|:.|.....:...||  ||.. |.|||.||.||||||:|  ..:....:..|:||:|  .||
Zfish   187 VVANDRCNALLGSGTVTNNMICAGLTQGGKDTCQGDSGGPMV--TRLCTVWVQAGITSWG--YGC 247

  Fly   245 T-KGYPSVFTRITAYLDWIGEVSGVHYP 271
            . ...|.|:||::.|..||.....::.|
Zfish   248 ADPNSPGVYTRVSQYQSWISSKISLNKP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/254 (31%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 80/256 (31%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.