DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and ela2l

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:277 Identity:88/277 - (31%)
Similarity:134/277 - (48%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFLLILVQGRSISC-LDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYL 71
            |.|.:||.| :.|| |.....|..|:.||...|.|.:|:|:.|..:..::.|..||.|||..:::
Zfish     5 VVLAVLVVG-AYSCGLPTFPPIVTRVVGGVDVRPNSWPWQISLQYKSGSNWYHTCGGSLIDKQWV 68

  Fly    72 LTAAHCVEKAVAITYYLG---------GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRL 127
            ||||||:..:.....:||         |.:.:...::|        :|..||..::.|||||::|
Zfish    69 LTAAHCISSSRTYRVFLGKHSLSQEENGSVAIGAGKII--------VHEAWNSFTIRNDIALIKL 125

  Fly   128 PEDALLCDSIRPIRLP--GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE 190
            .....:.|:|.|..||  |.....|:    |...:||||:.... .::|.|:.....|..:..|.
Zfish   126 ETAVTIGDTITPACLPEAGYVLPHNA----PCYVTGWGRLYTNG-PLADILQQALLPVVDHATCS 185

  Fly   191 YS---YANIKPTNICMDTTGGKSTCTGDSGGPL--VYSDPVQNADILIGVTSYGKKSGCTKGY-- 248
            .|   .:.:..:.:|....|..:.|.|||||||  ..||   .|..:.|:.|:|  ||.:..|  
Zfish   186 KSDWWGSQVTTSMVCAGGDGVVAGCDGDSGGPLNCAGSD---GAWEVHGIVSFG--SGLSCNYNK 245

  Fly   249 -PSVFTRITAYLDWIGE 264
             |:||||::||.|||.:
Zfish   246 KPTVFTRVSAYSDWISK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/249 (31%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 77/249 (31%)
Tryp_SPc 29..263 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.