DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss53

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:290 Identity:71/290 - (24%)
Similarity:122/290 - (42%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSI---SCLDMGHGIGGRIAGGELARANQFPYQV-----GLSIEEPNDMYCWCG 62
            ::|..:::::|...   :|...|.|......|..|  ..::|:|.     |:.|         |.
Mouse    10 LIVGAVVVIEGLQAAQRACGQRGPGPPEPQEGNTL--PGEWPWQASVRRQGVHI---------CS 63

  Fly    63 ASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPE------VHLHPDWNCQSLEND 121
            .||::|.::||||||.||..........|:..:.:|..:|...|      :.|...:|..|..:|
Mouse    64 GSLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSD 128

  Fly   122 IALVRLPEDAL---LCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTA-ISDNLRYVYRF 182
            :||::|....:   ||       ||     :.:|.: |..||.|....|::|: :|..||.:...
Mouse   129 LALLQLTHPTVQTTLC-------LP-----QPTYHF-PFGASCWATGWDQNTSDVSRTLRNLRLR 180

  Fly   183 VESNEDCEYSYANI---------KPTNICMDT-TGGKSTCTGDSGGPLVYSDP----VQNADILI 233
            :.|...|...|..:         :|..:|... .|.:..|.||||||::..:|    ||     :
Mouse   181 LISRPTCNCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQ-----V 240

  Fly   234 GVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262
            |:.|:..|  |. :..|.:.|.:..:..|:
Mouse   241 GIISFTSK--CAQEDTPVLLTDMAVHSSWL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/260 (25%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 5/20 (25%)
Tryp_SPc 45..271 CDD:238113 64/253 (25%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.