DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:258 Identity:84/258 - (32%)
Similarity:116/258 - (44%) Gaps:53/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVA---------ITYY 87
            |.||.:......||||  |:.|.|:..  ||.|:|::|::|||.|||:..:|         ..|.
Mosquito    47 IVGGHVVDIEMHPYQV--SVRELNEHI--CGGSIITNRWVLTAGHCVDDTIAAYMNVRVGSAFYA 107

  Fly    88 LGGVLRLAPRQLIRSTNP--EVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPI----RLPGLS 146
            .||.:           :|  .|..|||....|...|.||::|....:.....:||    ||....
Mosquito   108 KGGTI-----------HPVDSVTTHPDHVPYSWLADFALLQLKHAIVFSTIAQPIALAFRLDNAL 161

  Fly   147 SSRNSYDYVPAIASGWGR-MNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMD--TTG 207
            |.|.      .:.:|||| :|:|.:  .|.||.|...:.|...|..:| ..|..|.||..  ..|
Mosquito   162 SDRE------CVVTGWGRTLNEEES--FDKLRAVQIPLVSRVLCNATYEGKIDQTMICAGDFVDG 218

  Fly   208 GKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWIGEVSGVH 269
            ||.:|..|||||||.      .|:.:|:.|:||  ||. .|||.|::.:.....||..:  ||
Mosquito   219 GKGSCAYDSGGPLVC------GDMQVGIVSWGK--GCAMPGYPDVYSSVLYARAWINSI--VH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/249 (32%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 82/252 (33%)
Tryp_SPc 47..266 CDD:214473 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.