DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CLIPC1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_552698.3 Gene:CLIPC1 / 3291827 VectorBaseID:AGAP008835 Length:389 Species:Anopheles gambiae


Alignment Length:264 Identity:89/264 - (33%)
Similarity:135/264 - (51%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG 89
            ||.....|..||||:|.:||:...:...|..::...||.||:|||::|||.||:   .:..:...
Mosquito   136 GHTAVELIVDGELAKAREFPHMALIGFGEAPEIRYLCGGSLVSDRFILTAGHCL---TSTNFGPA 197

  Fly    90 GVLRLAPRQLIRSTN---PEVH------LHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGL 145
            .::||....|..||:   ||.:      .||::...|..|||||::|....:.....|||.|| |
Mosquito   198 TIVRLGELSLASSTDEAFPEDYDIAERIPHPEYKQTSHYNDIALIKLNRKVIFSPYARPICLP-L 261

  Fly   146 SSSRNSYDYVP---AIASGWGRMN---DESTAISDNLRYVYRFVESNEDCEYSYANIK------- 197
            .::      :|   |||:|||.:.   ::|:|:......::||    |:|:..:...:       
Mosquito   262 QAA------IPQKRAIATGWGAIGFGLEQSSALLKVTLDMFRF----EECKDQFEPTRKLRTGLN 316

  Fly   198 -PTNICMDTTGG-KSTCTGDSGGPL-VYSDP-VQNADILIGVTSYGKKSGCTKGYPSVFTRITAY 258
             .|.:|..:... |.||.||||||| ||:|. |.....:|||||:|:..|.. |.|:|:|.:.:|
Mosquito   317 ATTQLCAGSRNSTKDTCQGDSGGPLQVYNDANVYCTYTIIGVTSFGQNCGLA-GVPAVYTTVYSY 380

  Fly   259 LDWI 262
            |.||
Mosquito   381 LSWI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 85/256 (33%)
CLIPC1XP_552698.3 CLIP 39..79 CDD:197829
Tryp_SPc 143..386 CDD:238113 87/257 (34%)
Tryp_SPc 143..384 CDD:214473 85/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.