DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:254 Identity:74/254 - (29%)
Similarity:111/254 - (43%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVG-LSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            |.||......|.|||.. |::.:.:     ||.|:|..|::|||.|||:..:...|.:.      
Mosquito    39 IVGGMKVDIEQVPYQAAILTLGQVH-----CGGSIIGPRWVLTAYHCVDWLLPNFYEVA------ 92

  Fly    96 PRQLIRSTNP---------------EVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGL 145
                :.||||               |....|::       ||||.:|........:::.|  |.|
Mosquito    93 ----VGSTNPYEGQRILVQELFVPLETLSDPNF-------DIALAKLAHTLQYSSTVQCI--PLL 144

  Fly   146 SSSRNSYDYVPAIASGWGRMNDESTAISDN-LRYVYRFVESNEDCEYSYANI-KPTNICMDTTGG 208
            :|..:.....||..||:|...:.:   ||| |:.....|...:.|:.:|..: :...:|.....|
Mosquito   145 TSDSSLIPDTPAYISGFGYTKERA---SDNILKAAQIKVLPWDYCQQAYPYLMREFMLCAGFKEG 206

  Fly   209 K-STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWIGEV 265
            | .:|.|||||||:.     ||. |.||..||:  ||.: .:|.|:..:..:.|||.||
Mosquito   207 KVDSCQGDSGGPLIV-----NAK-LAGVVFYGE--GCARPHFPGVYISVPWFSDWIIEV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/249 (28%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 72/252 (29%)
Tryp_SPc 39..254 CDD:214473 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.