DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP011914

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_552329.3 Gene:AgaP_AGAP011914 / 3291452 VectorBaseID:AGAP011914 Length:398 Species:Anopheles gambiae


Alignment Length:266 Identity:82/266 - (30%)
Similarity:120/266 - (45%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHC-VEKAV 82
            ::| |.|......|..|.....|::|...||.....:.::  ||::::::|::|||||| :::..
Mosquito   146 LAC-DCGRHRTPTIVNGFPTLTNEYPMMAGLWDNSVSRVF--CGSTIVTNRHVLTAAHCLLDRTA 207

  Fly    83 AITYYLGG------------VLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCD 135
            |.|..|.|            .||:.....|:        ||.:|..|..||||||:..:..:...
Mosquito   208 AGTRVLVGEQNTNITNETPYTLRMLVSTFIK--------HPSYNPTSKANDIALVQTFDTIVFNP 264

  Fly   136 SIRPIRLP---GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYA-NI 196
            .:..:.||   |.||..|:    ...|.|||.: |.....|..|......|.|:..|....: .|
Mosquito   265 GVGRVCLPFRFGTSSFENA----RLSALGWGAI-DFGAPSSKELLQTTLAVVSSTSCGTKLSRTI 324

  Fly   197 KPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDW 261
            ..:.:| ....|..||..||||||.|:||.......|||..:|  ..|...:|||.||:|:||||
Mosquito   325 LASQMC-TFAAGNDTCQNDSGGPLYYTDPNSQLVYSIGVVGFG--VACASSFPSVNTRVTSYLDW 386

  Fly   262 IGEVSG 267
            |...:|
Mosquito   387 ISSTTG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 76/247 (31%)
AgaP_AGAP011914XP_552329.3 CUB 34..143 CDD:238001
Tryp_SPc 158..390 CDD:238113 78/249 (31%)
Tryp_SPc 158..387 CDD:214473 76/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.