DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP007141

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_565054.3 Gene:AgaP_AGAP007141 / 3290313 VectorBaseID:AGAP007141 Length:254 Species:Anopheles gambiae


Alignment Length:270 Identity:85/270 - (31%)
Similarity:127/270 - (47%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGH----GIGG--RIAGGELARANQFPYQVGLSIEEPNDMYCWC 61
            :.:|.|::|.     |:.||...|    .:.|  |:.||..|.....||||.|.....:.    |
Mosquito     1 MKSIGVYVLC-----SVLCLIYAHPTPDDVEGNDRVVGGTDAPPGAAPYQVSLQGLFGHS----C 56

  Fly    62 GASLISDRYLLTAAHCVEKAVAITYYLGGV-LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALV 125
            |.::|...::|||||||:.:|..|..|.|. |..|..|  |....:.::|..:|.....||||||
Mosquito    57 GGAIIDRDWILTAAHCVQTSVKFTKVLVGTNLLNAGGQ--RYAVEKFYVHSRYNNPVFHNDIALV 119

  Fly   126 RLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE 190
            :|.......|.::||..    |.|...:......:||||::. :.|:.:.|:.:.......|:|:
Mosquito   120 KLKSMIQYDDLVQPIAY----SEREIPENATLTLTGWGRLSG-TGAMPNKLQTIDLTYVPYEECK 179

  Fly   191 YSYANIKPTNI---CMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVF 252
            ..:.|.:..:|   |..|..|:..|.|||||||||...      |:||.::|..  |..|||..:
Mosquito   180 RLHGNSENVDIGHVCTLTKKGEGACNGDSGGPLVYEGK------LVGVVNFGVP--CALGYPDAY 236

  Fly   253 TRITAYLDWI 262
            .|::.|.|||
Mosquito   237 ARVSYYHDWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/234 (32%)
AgaP_AGAP007141XP_565054.3 Tryp_SPc 30..246 CDD:214473 75/234 (32%)
Tryp_SPc 31..249 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.