DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005663

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_556312.2 Gene:AgaP_AGAP005663 / 3290018 VectorBaseID:AGAP005663 Length:317 Species:Anopheles gambiae


Alignment Length:253 Identity:90/253 - (35%)
Similarity:131/253 - (51%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGL--SIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLR 93
            ||..|:.|...|||||:.|  :......:   ||.|::::.|:|||||||         :.|...
Mosquito    72 RITNGQEATPGQFPYQIALLSNFATGTGL---CGGSVLTNNYILTAAHCV---------ISGATT 124

  Fly    94 LA-----------------PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIR 141
            ||                 .:|.|..|:..:..||.:|..::.||||:|||.........|:|||
Mosquito   125 LATSGTAIMGAHNRNVNEPTQQRIGFTSAGIRAHPGYNPTNIRNDIAVVRLNSPITFTARIQPIR 189

  Fly   142 LPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC--EYSYANIKPTNICMD 204
            |||.|.||....:...: ||:||..: :.|.|..:.:....|.:|.||  .::.|.|:|.|:|:.
Mosquito   190 LPGRSDSRQFGGFTGTV-SGFGRTTN-TGATSPVVMFTSNPVMTNADCIARWNTALIQPQNVCLS 252

  Fly   205 TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            ..||:|:|.|||||||...|   ...:.||:.|:|..:||:.|.|||:.|::.|||||
Mosquito   253 GDGGRSSCNGDSGGPLTVQD---GGSLQIGIVSFGSAAGCSIGMPSVYARVSFYLDWI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 88/251 (35%)
AgaP_AGAP005663XP_556312.2 Tryp_SPc 72..307 CDD:214473 88/251 (35%)
Tryp_SPc 73..310 CDD:238113 89/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.