DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG15046

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_573298.1 Gene:CG15046 / 32833 FlyBaseID:FBgn0030927 Length:494 Species:Drosophila melanogaster


Alignment Length:221 Identity:41/221 - (18%)
Similarity:73/221 - (33%) Gaps:92/221 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GIGGRIAGGE----------LARANQF--PYQVGLSIEEPNDMY----CWCGASLISDRYLLTAA 75
            |:.|..:.|:          :|||::.  .|:...|:..||..:    ..|.|.:::.:.|::||
  Fly   231 GVQGDSSEGKAAEDPLELAAIARADRLLPHYRHLASLAHPNAAFDGHLHHCAALVLTPQLLVSAA 295

  Fly    76 HCVEKAVAI------------TYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLP 128
            .|...:.|:            ..||..::||.                     ..:.|::|:||.
  Fly   296 GCERPSHAVFGVADLRDVDADEDYLADIVRLV---------------------QFQKDLSLIRLQ 339

  Fly   129 EDALLCDSIRPIRLPGLSSSRNSYDYV-------------PAIASGWGRMNDESTAISDNLRYVY 180
            :         |:||...:|:..|...:             ..:|.|||:..|             
  Fly   340 D---------PLRLGSQTSANVSVAPICTQFELTRLQRSGSLVAVGWGKGED------------- 382

  Fly   181 RFVESNEDCEY--SYANIKPTNICMD 204
                  .||..  ....::||..|.|
  Fly   383 ------TDCPLFEMPMRLRPTWACGD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 39/217 (18%)
CG15046NP_573298.1 CLIP 35..82 CDD:197829
CLIP 168..215 CDD:197829
Tryp_SPc 274..>379 CDD:304450 23/134 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.