DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and psh

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:119/264 - (45%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVGLS-IEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYY--LGGVLR 93
            |.||.......:|:...:. |....|..  ||.|||:.|::|||||||........:  ||.|..
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFR--CGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI 206

  Fly    94 LAPRQ-----LIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRP--IRLPGLSSSRNS 151
            ..|..     :|||    |.:||.: ..:..||||::.|..|.:..|:|||  :.........||
  Fly   207 ENPDHSYQDIVIRS----VKIHPQY-VGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNS 266

  Fly   152 YDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNI-------------CM 203
            ..:|    :|||.:|..:.|.|..|......:...:.|..|||. :|.:|             .:
  Fly   267 KFFV----AGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAE-QPGSIRLLKQGVIDSLLCAI 326

  Fly   204 DTTGGKSTCTGDSGGPLVYSDPVQNA-DILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSG 267
            |.......|.|||||||::...|::. ..::||.|.|  .||....|.::||:::|||:|   .|
  Fly   327 DQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSG--FGCATVTPGLYTRVSSYLDFI---EG 386

  Fly   268 VHYP 271
            :.:|
  Fly   387 IVWP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/253 (30%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 77/253 (30%)
Tryp_SPc 144..387 CDD:238113 78/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.