DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Hayan

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:274 Identity:86/274 - (31%)
Similarity:124/274 - (45%) Gaps:48/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGR-----IAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYL 88
            ||:     |..||......:|:...::..........||.|||:.|::|||||||....:...::
  Fly   377 GGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFV 441

  Fly    89 G-GVLRLAPRQLIRSTNPE----------VHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL 142
            . |.|.:        .|||          |.:|||::..|...|||:::|.|||...|.|||..|
  Fly   442 RLGALNI--------ENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACL 498

  Fly   143 -PGLSSSRNSYDYVPAIASGWGRMNDESTAISD-NLRYVYRFVESNEDCEYSYANIKPTN----- 200
             ...|....:|.|   ..:|||.||..:.|:|. .||.....|.::| |..|:|.....|     
  Fly   499 YTDRSDPPANYKY---FVAGWGVMNVTNRAVSKILLRAALDLVPADE-CNASFAEQPSANRTLRR 559

  Fly   201 ------IC-MDTTGGKSTCTGDSGGPLVYS-DPVQNADILIGVTSYGKKSGCTKGYPSVFTRITA 257
                  :| .|....|..|.|||||||:.. |.|.....::||.|.|  .||....|.::||:::
  Fly   560 GVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSG--FGCATKTPGLYTRVSS 622

  Fly   258 YLDWIGEVSGVHYP 271
            :||:|   .|:.:|
  Fly   623 FLDYI---EGIVWP 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 81/261 (31%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 81/256 (32%)
Tryp_SPc 385..630 CDD:238113 82/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.