DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG31220

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:268 Identity:81/268 - (30%)
Similarity:119/268 - (44%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFP------YQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG 89
            |:.||.....|::|      |:...:.....::...||.|||:.||:|||||||...|.      
  Fly   103 RVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVL------ 161

  Fly    90 GVLRLAPRQLIRSTNPE------------VHL---------HPDWN--CQSLENDIALVRLPEDA 131
            .:.|:...:...|.||:            .||         |.|::  ..:..||||||||.|..
  Fly   162 QIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPV 226

  Fly   132 LLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGR--MNDESTAISDNLRYVYRFVESNEDC--EYS 192
            ....:..||.:  |...|:...:...:| |||:  |.|..:.:   |::....|...|:|  :|:
  Fly   227 RYTMAYYPICV--LDYPRSLMKFKMYVA-GWGKTGMFDTGSKV---LKHAAVKVRKPEECSEKYA 285

  Fly   193 YANIKPT-NICMDTTGGKSTCTGDSGGPLVYSD--PVQNADILIGVTSYGKKSGCTKGYPSVFTR 254
            :.:..|. .||......:.||.||||.||:.:.  ..:....|.|:||||...| |.|:||||||
  Fly   286 HRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCG-TIGWPSVFTR 349

  Fly   255 ITAYLDWI 262
            ...:..||
  Fly   350 TAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/266 (30%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 79/266 (30%)
Tryp_SPc 104..360 CDD:238113 80/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.