DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG8952

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:248 Identity:85/248 - (34%)
Similarity:134/248 - (54%) Gaps:14/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL 92
            |..||..|..|:..|||:||.|..:..:|:.  ||.|:|||.::||||||.....:| :.:.|.:
  Fly    34 IDNRIVSGSDAKLGQFPWQVILKRDAWDDLL--CGGSIISDTWVLTAAHCTNGLSSI-FLMFGTV 95

  Fly    93 RLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA 157
            .|.....:..|:..:.:|||:| ..|.||::|::|||......:|:.|:|.|  ...:|.|||.:
  Fly    96 DLFNANALNMTSNNIIIHPDYN-DKLNNDVSLIQLPEPLTFSANIQAIQLVG--QYGDSIDYVGS 157

  Fly   158 IA--SGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN--IKPTNICMDTTGGK--STCTGDS 216
            :|  :|:|...||....|:.|.|....:..|.||...|..  :..:.:|.....|.  |||||||
  Fly   158 VATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDS 222

  Fly   217 GGPLV-YSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGV 268
            ||||: |:..:|... .||:.|:..:..||...||.:.|::::|.:|.:.:|:
  Fly   223 GGPLILYNKTIQQWQ-QIGINSFVAEDQCTYRLPSGYARVSSFLGFIADKTGI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/237 (35%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 82/237 (35%)
Tryp_SPc 38..271 CDD:238113 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.