DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and plg

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:263 Identity:80/263 - (30%)
Similarity:122/263 - (46%) Gaps:68/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRL 94
            |||.||.:::.:.:|:|:.|   .......:||.:||..::::|||||:|               
Zfish   587 GRIVGGCVSKPHSWPWQISL---RTRGKIHFCGGTLIDPQWVVTAAHCLE--------------- 633

  Fly    95 APRQLIRSTNPEVH-----LHPDWNCQSLE--------------NDIALVRLPEDALLCDSIRPI 140
                  ||.:|..:     :|.:...:|.:              .||||::|...||:.|.:.|:
Zfish   634 ------RSDSPSAYKIMLGIHTERATESSKQERDVTKIIKGPAGTDIALLKLDRPALINDKVSPV 692

  Fly   141 RLPGLSSSRNSYDY-VPA----IASGWGRMNDESTAISDNLRYVYRFVESNEDCEY-SYAN--IK 197
            .||       ..|| ||:    ..:|||...|  |.....|:.....|..|:.|.. |:.|  :|
Zfish   693 CLP-------EKDYIVPSNTECYVTGWGETQD--TGGEGYLKETGFPVIENKVCNRPSFLNGRVK 748

  Fly   198 PTNICM-DTTGGKSTCTGDSGGPLV-YSDPVQNADILIGVTSYGKKSGCTKGY-PSVFTRITAYL 259
            ...:|. :..||..:|.|||||||| |:   ||..:|.||||:|  .||.... |.|:||::.::
Zfish   749 DHEMCAGNIEGGNDSCQGDSGGPLVCYA---QNTFVLQGVTSWG--LGCANAMKPGVYTRVSKFV 808

  Fly   260 DWI 262
            |||
Zfish   809 DWI 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/260 (30%)
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527
Tryp_SPc 589..813 CDD:238113 78/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.