DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Ser7

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:298 Identity:88/298 - (29%)
Similarity:129/298 - (43%) Gaps:45/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STILVFLLILVQGRSISCLDM-------GHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW- 60
            ||..:.||.....|..|.:|.       |.....|:.||......:||:...|..|..:....: 
  Fly    97 STTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYA 161

  Fly    61 CGASLISDRYLLTAAHCVE------KAVAITYY-----------LGGVLRLAPRQLIRSTNPEVH 108
            ||||.|:.|:|||||||:.      .|..:..:           |.||...||.. ||.|...:.
  Fly   162 CGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPH-IRVTIDRIL 225

  Fly   109 LHPDWNCQSLENDIALVRL--PEDALLCDSIRPIRLPGLSSSRNSYDY----VPAIASGWGRMND 167
            .|..::..:..|||||:||  |.:.|...::.|:.||   ..|..|..    ..|..||||:  .
  Fly   226 PHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLP---PQRGRYANQLAGSAADVSGWGK--T 285

  Fly   168 ESTAISDNLRYVYRFVESNEDC-EYSYANIKPT----NICMDTTGGKSTCTGDSGGPLVYSDPVQ 227
            ||:..|...:.....::..:.| |..|.:.|.|    .:|.....|..:|:|||||||.......
  Fly   286 ESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTA 350

  Fly   228 NAD---ILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            :.:   .|.||.|.|:|...|..:..::||:::|:|||
  Fly   351 SGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/262 (30%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/262 (30%)
Tryp_SPc 133..391 CDD:238113 79/262 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.