DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG31269

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:303 Identity:85/303 - (28%)
Similarity:133/303 - (43%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGR-SISCLDM-GHGIGG------RIAGGELARANQFPYQVGL-SIEEPNDMY 58
            :|.:::.:|:.:.|. ||:.:.: |:...|      ||.||:.|.....|||:.| .|...:.  
  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS-- 63

  Fly    59 CWCGASLISDRYLLTAAHCVEKA-----VAIT-----------YYLGGVLRLAPRQLIRSTNPEV 107
              ||.::|::.::||||||||.|     |.:|           |:|                ..:
  Fly    64 --CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFL----------------KAI 110

  Fly   108 HLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVP------AIASGWGRMN 166
            |:|.:::...:.|||||:.|.|.....:..:||.||          .||      .|.:|||...
  Fly   111 HIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP----------LVPMQPGDEVILTGWGSTV 165

  Fly   167 DESTAISD----NLRYV-YR----FVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVY 222
            ...|:..|    .|:|| :|    .:.::|||:..:       ||..:..|:..|.|||||||| 
  Fly   166 LWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH-------ICTFSRLGEGACHGDSGGPLV- 222

  Fly   223 SDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEV 265
                 :...|:|:.::|..  |..|.|.|...:..|.|||..|
  Fly   223 -----SNGYLVGLVNWGWP--CATGVPDVHASVYFYRDWIRNV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/262 (29%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/262 (29%)
Tryp_SPc 38..258 CDD:238113 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.