DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG31267

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:292 Identity:73/292 - (25%)
Similarity:124/292 - (42%) Gaps:66/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLIL------VQGRSISC--LDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYC 59
            :||:::.||.|      ::.|:.:.  .:..:....||.|||.:.....||.|.|.....|.   
  Fly     8 VSTLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNH--- 69

  Fly    60 WCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTN------------PEVHLHPD 112
            :|..|:|.|::::|||.|          |.| ||....|::.:|.            .::.:|.:
  Fly    70 FCAGSIIHDQWVITAASC----------LAG-LRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCN 123

  Fly   113 WNCQSLENDIALVRLP-----EDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAI 172
            ::.....|||||::..     :|.....:|.|  |..|:.......|      |:|     ||.|
  Fly   124 FDSPMYHNDIALIKTHALFDYDDVTQNITIAP--LEDLTDGETLTMY------GYG-----STEI 175

  Fly   173 SDNLRYVYRFVE----SNEDCEYSYA---NIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD 230
            ..:..:..:.::    :.|.|..:|.   ::...::|.....|...|.||:|||:     |.:..
  Fly   176 GGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPI-----VDSRG 235

  Fly   231 ILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            .|:||.::|..  |..|:|.||.||:.|..||
  Fly   236 RLVGVGNWGVP--CGYGFPDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/254 (26%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/254 (26%)
Tryp_SPc 45..268 CDD:238113 66/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.