DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss6

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:263 Identity:81/263 - (30%)
Similarity:124/263 - (47%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DMG-HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV-EKAVAI- 84
            |.| .|...||.||.::...::|:|..|.|...:    .||.:||:||:::|||||. |.::|. 
  Rat   567 DCGLQGPSSRIVGGAMSSEGEWPWQASLQIRGRH----ICGGALIADRWVITAAHCFQEDSMASP 627

  Fly    85 ---TYYLGGVLRLAPRQLIRSTN------PEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPI 140
               |.:||.:     ||..|...      ..:.|||.....|.:.|:||::|....:...::||:
  Rat   628 RLWTVFLGKM-----RQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPV 687

  Fly   141 RLPGLSSSRNSYDYVP---AIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYA-NIKPTNI 201
            .||.     .|:.:.|   ...:|||...:.... |..|:.|...:...:.|..:|. .:.|..:
  Rat   688 CLPA-----RSHFFEPGQHCWITGWGAQREGGPG-SSTLQKVDVQLIPQDLCNEAYRYQVTPRML 746

  Fly   202 CMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPS---VFTRITAYLDWI 262
            |.. ..|.|..|.||||||||..:| .....|.|:.|:|  .||  |.|:   |:||:|..::||
  Rat   747 CAGYRKGKKDACQGDSGGPLVCKEP-SGRWFLAGLVSWG--LGC--GRPNFFGVYTRVTRVVNWI 806

  Fly   263 GEV 265
            .:|
  Rat   807 QQV 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/249 (30%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 75/249 (30%)
Tryp_SPc 577..809 CDD:238113 76/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.