DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG6041

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:280 Identity:86/280 - (30%)
Similarity:124/280 - (44%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW-----CG 62
            |..|.:||..|..|.|:|....|. |..:|.||..|...|..|||.:.: ..||...:     ||
  Fly     7 ILAIALFLGALASGESLSSETAGK-IEPKIVGGYDASIEQVSYQVSIRL-TANDKKSYGSGHLCG 69

  Fly    63 ASLISDRYLLTAAHCVEKAVAITYYLGG--VLRLAPRQLIRSTN-------PEVHLHPDWNCQSL 118
            ..:||.|.:.|||||........|...|  ||.:....|..||:       .::..|.::|..:|
  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL 134

  Fly   119 ENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYV----PAIASGWGRMNDESTAISDNLRYV 179
            .|||||       :..:...|...|.:::...:...|    ..:.||||.:....|..|:.|:..
  Fly   135 TNDIAL-------MFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAA 192

  Fly   180 YRFVESNEDCEYSYANIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSG 243
            ...:.|...|..||.:|..:.:|.. .:||...|.||||||:..:      .:|.|:.|||  :|
  Fly   193 TVPIVSYTTCRISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCN------GMLAGIVSYG--AG 249

  Fly   244 C-TKGYPSVFTRITAYLDWI 262
            | ..|||.|:|.::.|.|||
  Fly   250 CAAPGYPGVYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/250 (30%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 74/250 (30%)
Tryp_SPc 35..272 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.