DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss11e

DIOPT Version :10

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001406557.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:423 Species:Rattus norvegicus


Alignment Length:253 Identity:78/253 - (30%)
Similarity:118/253 - (46%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCW-----CGASLISDRYLLTAAHCV---EKAVAITYY 87
            ||.||..|...::|:|..|.         |     |||:|||:.:|::||||.   :.....|..
  Rat   191 RIVGGTSAEEGEWPWQSSLQ---------WDGSHRCGATLISNTWLVSAAHCFRTHKDPSRWTAS 246

  Fly    88 LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSY 152
            .|..|:  |.:|..... .:.:|..:|..|.:.|||||.|.......:::..:.||..     ::
  Rat   247 FGATLQ--PPKLTTGIR-RIIVHEKYNYPSHDYDIALVELSRPVPCTNAVHKVCLPDA-----NH 303

  Fly   153 DYVPA---IASGWGRMNDESTAISDNLRYVYRFVESNEDCE--YSY-ANIKPTNICMD-TTGGKS 210
            ::.|.   ..:|:|.:.::..| .:.||.|.......:.|.  .|| ..|.|..:|.. ..|.|.
  Rat   304 EFQPGQRMFVTGFGALRNDGFA-QNYLRQVQVDYIDTQTCNRPQSYNGAITPRMLCAGFLKGEKD 367

  Fly   211 TCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGV 268
            .|.||||||||..| |::...|.||.|:|.:.| ....|.|:||:||:.|||...:|:
  Rat   368 ACQGDSGGPLVTPD-VRDVWYLAGVVSWGDECG-QPNKPGVYTRVTAFRDWITSNTGI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/245 (31%)
Tmprss11eNP_001406557.1 SEA 50..146 CDD:460188
Tryp_SPc 192..420 CDD:238113 76/247 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.