DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss42

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:249 Identity:77/249 - (30%)
Similarity:121/249 - (48%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            :|.||..|...::|:||.|.:..   |:. ||.||::.:::||||||:...|.....:|.  |..
  Rat    83 KIMGGVDAEEGKWPWQVSLRVRH---MHV-CGGSLLNSQWVLTAAHCIHSRVQYNVKMGD--RSV 141

  Fly    96 PRQLIRSTNP--EVHLHPDWNCQS-LENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA 157
            .||......|  .:.:||.::..: ::|||||::|.:......||.||.:|      ....:|.|
  Rat   142 YRQNTSLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVP------TGTFHVKA 200

  Fly   158 ----IASGWGRMNDESTAI-SDNLRYVYRFVESNEDCEYSYANIKPTN--------ICMDTTGGK 209
                ..:|||:.:..:..| ::.|:.|.:.:...|:|......:..|:        :|....|||
  Rat   201 GTKCWVTGWGKPDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRGMVCAYKEGGK 265

  Fly   210 STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWI 262
            ..|.|||||||  |....|..:.|||.|:|  .|| .||:|.|:|.:..|..|:
  Rat   266 DACQGDSGGPL--SCEFDNRWVQIGVVSWG--IGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 76/247 (31%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 76/246 (31%)
Tryp_SPc 84..315 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.