DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Cela3b

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:270 Identity:88/270 - (32%)
Similarity:132/270 - (48%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLL 72
            :.|:.|..|    |....:....|:..||.|....:|:||.|..|:....:..||.:||:..:::
  Rat     8 LLLVALASG----CGQPSYNPSSRVVNGEDAVPYSWPWQVSLQYEKDGSFHHTCGGTLIAPDWVM 68

  Fly    73 TAAHCVEKAVAITYYLG----GVLRLAPRQLIRSTNPEVHLHPDW--NCQSLENDIALVRLPEDA 131
            ||.||:..:......||    || ...|.|:|.....::.:||.|  ||.|..||||||:|...|
  Rat    69 TAGHCISTSRTYQVVLGEFERGV-EEGPEQVIPVNAGDLFVHPKWNSNCVSCGNDIALVKLSRSA 132

  Fly   132 LLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC---EYSY 193
            .|.|:::...||  .:.....:..|...|||||::... .:.|.|:.....|.....|   ::..
  Rat   133 QLGDTVQLACLP--PAGEILPNGAPCYISGWGRLSTNG-PLPDKLQQALLPVVDYAHCSKWDWWG 194

  Fly   194 ANIKPTNICMDTTGG--KSTCTGDSGGPLVYSDPVQNADILI-GVTSYGKKSGC-TKGYPSVFTR 254
            .::|.|.:|   .||  :|.|.|||||||  :.|.:|....: ||||:....|| |...|:||||
  Rat   195 FSVKKTMVC---AGGDIQSGCNGDSGGPL--NCPAENGTWQVHGVTSFVSSLGCNTLKKPTVFTR 254

  Fly   255 ITAYLDWIGE 264
            ::|:.:||.|
  Rat   255 VSAFNEWIEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 81/243 (33%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 81/243 (33%)
Tryp_SPc 28..265 CDD:238113 83/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.