DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1c9

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_786935.1 Gene:Klk1c9 / 292868 RGDID:727805 Length:259 Species:Rattus norvegicus


Alignment Length:280 Identity:81/280 - (28%)
Similarity:125/280 - (44%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQV---GLSIEEPNDMYCWCGASLISDR 69
            ::.|||....|:..:|.......|:.||.....|..|:||   |.:         :||..||...
  Rat     1 MWFLILFLALSLGQIDAAPPGQSRVVGGYNCETNSQPWQVAVIGTT---------FCGGVLIDPS 56

  Fly    70 YLLTAAHCVEKAVAITYYLGGVLR---LAPRQLIRSTNPEVHLHPDW-----------NCQSLEN 120
            :::|||||..|...:......:::   .|.|:|:..:    ..|||:           ......|
  Rat    57 WVITAAHCYSKNYRVLLGRNNLVKDEPFAQRRLVSQS----FQHPDYIPVFMRNHTRQRAYDHNN 117

  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVES 185
            |:.|:.|.:.|.:...::.|.||.......|.    .:|||||..|.....:|.:|:.|...:.|
  Rat   118 DLMLLHLSKPADITGGVKVIDLPTEEPKVGSI----CLASGWGMTNPSEMKLSHDLQCVNIHLLS 178

  Fly   186 NEDCEYSYANIK-PTNIC---MDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK 246
            ||.|..:|.||: ...:|   ||  |||.||||||||||:..      .:|.|:|| |..:.|.|
  Rat   179 NEKCIETYKNIETDVTLCAGEMD--GGKDTCTGDSGGPLICD------GVLQGLTS-GGATPCAK 234

  Fly   247 -GYPSVFTRITAYLDWIGEV 265
             ..|:::.::..:..||.:|
  Rat   235 PKTPAIYAKLIKFTSWIKKV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/252 (29%)
Klk1c9NP_786935.1 Tryp_SPc 24..251 CDD:214473 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.