DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk13

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:280 Identity:75/280 - (26%)
Similarity:116/280 - (41%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRS---ISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGAS 64
            ::||....|.|..|.|   ...|:..:|..|.:.||.....:..|:|..|.:..    ...||..
  Rat     5 VATIACLTLALSGGISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAALLVRG----RLLCGGV 65

  Fly    65 LISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHL-------HPDWNCQ----SL 118
            |:..:::||||||.:.        |..:.|....|.|..|.|..:       ||::...    :.
  Rat    66 LVHPKWVLTAAHCRKD--------GYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLNH 122

  Fly   119 ENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVP----AIASGWGRMNDESTAISDNLRYV 179
            ::||.|:.|.....|.:.:|.::|       ::.|.:|    ...||||............|:..
  Rat   123 DHDIMLLELKSPVQLSNHVRTLQL-------SADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCA 180

  Fly   180 YRFVESNEDCEYSY-ANIKPTNICMDT-TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKS 242
            ...:.|:|:|...| ..|....:|..| .|||.:|.|||||||:.:..      |.|:.|:|...
  Rat   181 NIELRSDEECRQVYPGKITANMLCAGTKEGGKDSCEGDSGGPLICNGK------LYGIISWGDFP 239

  Fly   243 GCTKGYPSVFTRITAYLDWI 262
            ......|.|:||::.||.||
  Rat   240 CGQPNRPGVYTRVSKYLRWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 64/247 (26%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.