DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Gzmm

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:295 Identity:76/295 - (25%)
Similarity:128/295 - (43%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASL 65
            |::...|:.||.|.     :...:|:....:|.||..|..:..||.|.|.    |.....||..|
  Rat     1 MEVRWSLLLLLALK-----TLWAVGNRFEAQIIGGREAVPHSRPYMVSLQ----NTKSHVCGGVL 56

  Fly    66 ISDRYLLTAAHCVEKAV------------------AITYYLGGVLRLAPRQLIRSTNPEVHLHPD 112
            :..:::||||||:.:.:                  .:|:|:        :|.|:        ||.
  Rat    57 VHQKWVLTAAHCLSEPLQQLKLVFGLHSLHDPQDPGLTFYI--------KQAIK--------HPG 105

  Fly   113 WNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIAS-----GWGRMNDESTAI 172
            :|.: .|||:||::|........:::|:.||     |...| .||..|     ||| :..:...:
  Rat   106 YNLK-YENDLALLKLDGRVKPSKNVKPLALP-----RKPRD-KPAEGSRCSTAGWG-ITHQRGQL 162

  Fly   173 SDNLRYVYRFVESNEDCEYS-YAN--IKPTNICMDT-TGGKSTCTGDSGGPLVYSDPVQNADILI 233
            :.:|:.:...:.....|..| :.|  :..:.:|:.. ..|::.|.||||||||......:     
  Rat   163 AKSLQELDLRLLDTRMCNNSRFWNGVLTDSMLCLKAGAKGQAPCKGDSGGPLVCGKGKVD----- 222

  Fly   234 GVTSYGKKSGCTKGY-PSVFTRITAYLDWIGEVSG 267
            |:.|:..|: ||..: |:|.|.:..|..||.:|.|
  Rat   223 GILSFSSKN-CTDIFKPTVATAVAPYSSWIRKVIG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 66/258 (26%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 68/260 (26%)
Trypsin 27..251 CDD:278516 66/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.