DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk6

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_062048.1 Gene:Klk6 / 29245 RGDID:3419 Length:251 Species:Rattus norvegicus


Alignment Length:271 Identity:72/271 - (26%)
Similarity:115/271 - (42%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69
            |:....|.|:..:|....|.     .::..|.....|..|:|..|.    ...:..||..|:..:
  Rat     7 TVKTLALCLILAKSAWSEDQ-----DKVVHGGPCLKNSHPFQAALY----TSGHLLCGGVLVGPQ 62

  Fly    70 YLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTN--------PEVHLHPDWNCQSLENDIALVR 126
            ::||||||  |...:..|||       :..:|.|.        ....:||.:|.|:.:|||.:|.
  Rat    63 WVLTAAHC--KKPNLEVYLG-------KHNLRQTETFQRQISVDRTIVHPRYNPQTHDNDIMMVH 118

  Fly   127 LPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEY 191
            |.........|:|:.|....|.:|....:    .|||:|  |:....|.::.....:.|.|:||.
  Rat   119 LKRPVKFSQRIQPLPLKKDCSEKNPDCQI----LGWGKM--ENGEFPDTIQCADVQLVSREECER 177

  Fly   192 SY-ANIKPTNICM-DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTR 254
            :| ..|..:.:|. |...|..:|.||||||||....::      |:.|:|.....:|..|.|:|.
  Rat   178 AYPGKITRSMVCAGDKREGNDSCQGDSGGPLVCGGHLR------GIVSWGDMPCGSKEKPGVYTD 236

  Fly   255 ITAYLDWIGEV 265
            :..::.||..:
  Rat   237 VCTHIRWIQNI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/240 (27%)
Klk6NP_062048.1 Tryp_SPc 28..244 CDD:214473 65/240 (27%)
Tryp_SPc 29..247 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.