DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and F11

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:273 Identity:86/273 - (31%)
Similarity:124/273 - (45%) Gaps:50/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HGIGG---------------------RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69
            ||.||                     |:.||..:...::|:||.|...:.:    .||.|:|.:|
  Rat   361 HGRGGISGYTLRLCKMDNVCTTKIRPRVFGGAASVHGEWPWQVTLHTTQGH----LCGGSIIGNR 421

  Fly    70 YLLTAAHC---VEKAVAITYYLGGVLRLAPRQLIRSTN----PEVHLHPDWNCQSLENDIALVRL 127
            ::||||||   .|....:..| ||::..:  ::...|.    .|:.:|..:.......||||::|
  Rat   422 WILTAAHCFSGTETPKTLRVY-GGIVNQS--EINEDTTFFRVQEMIIHDQYTSAESGFDIALLKL 483

  Fly   128 PEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWG--RMNDESTAISDNLRYVYRFVESNEDCE 190
            .......|..|||.||  |....:..:.....:|||  :..||   :...|:.....:.|||:|:
  Rat   484 EPAMNYTDFQRPICLP--SKGDRNVVHTECWVTGWGYTKSRDE---VQSTLQKAKVPLVSNEECQ 543

  Fly   191 YSYANIKPTN--ICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-TKGYPSV 251
            ..|...|.||  ||.. ..|||.||.|||||||  |........|:|:||:|:  || .|..|.|
  Rat   544 TRYRKHKITNKVICAGYKEGGKDTCKGDSGGPL--SCKHNGVWHLVGITSWGE--GCGQKERPGV 604

  Fly   252 FTRITAYLDWIGE 264
            :|.:..|:|||.|
  Rat   605 YTNVAKYVDWILE 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/243 (33%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519 4/12 (33%)
Tryp_SPc 387..615 CDD:214473 79/243 (33%)
Tryp_SPc 388..615 CDD:238113 78/242 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.