DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss15

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:273 Identity:86/273 - (31%)
Similarity:137/273 - (50%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSISCLD--MGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLT 73
            |||:|....||.:  :...:|.:|.||...:|..:|:.|.|...:.:.....|||||:|..:|::
  Rat   766 LILLQCNHKSCGEKMVTQKVGPKIVGGSDTQAGAWPWVVALYYRDRSGDRLLCGASLVSSDWLVS 830

  Fly    74 AAHCVEK----AVAITYYLGGVLR--LAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDAL 132
            |||||.:    ....|..||..::  |...|::|.....:.::|.::.:...||||::.|.....
  Rat   831 AAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDRIVINPHYDKRRKVNDIAMMHLEFKVN 895

  Fly   133 LCDSIRPIRLPGLSSSRNSYDYVP----AIASGWG--RMNDESTAISDNLRYVYRFVESNEDC-- 189
            ..|.|:||.||     ..:..:.|    :|| |||  ::|..||.  |.|:.....:.|||.|  
  Rat   896 YTDYIQPICLP-----EENQTFTPGRMCSIA-GWGYNKINAGSTV--DVLKEADVPLVSNEKCQQ 952

  Fly   190 ---EYSYANIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYP 249
               ||   :|..:.:|.. ..||..:|.|||||||:..:  .|...|:||||:|.:  |. ..:|
  Rat   953 QLPEY---DITESMLCAGYEEGGTDSCQGDSGGPLMCQE--NNRWFLVGVTSFGVQ--CALPNHP 1010

  Fly   250 SVFTRITAYLDWI 262
            .|:.|::.:::||
  Rat  1011 GVYARVSQFIEWI 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/249 (31%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060
Tryp_SPc 789..1025 CDD:238113 79/250 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.