DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss34

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:292 Identity:88/292 - (30%)
Similarity:133/292 - (45%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCL--------DMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW-- 60
            :|.||.:     ::.||        |.|..:.| |.||....|::||:||.|...... :..|  
  Rat     5 MLWFLFL-----TLPCLGSTMPLTPDSGQELVG-IVGGCPVSASRFPWQVSLRFYNMK-LSKWEH 62

  Fly    61 -CGASLISDRYLLTAAHCVE----KAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLE- 119
             ||.|||..:::||||||||    :|......:|.:......||::..  ::..||.:: :.|. 
  Rat    63 ICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVA--KIIRHPKFS-EKLSA 124

  Fly   120 ---NDIALVRLPEDALLCDSIRPIRLPGLS---SSRNSYDYVPAIASGWGRMNDESTAISD-NLR 177
               .||||::|....:|.:.:.|:.||..|   ||:.::     ..:|||.:......... :||
  Rat   125 PGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTW-----WVAGWGVIEGHRPLPPPCHLR 184

  Fly   178 YVYRFVESNEDCEYSYAN----------IKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD-I 231
            .|...:..|.|||..|..          ||...:|.... |:.:|..|||||||..   .|.. :
  Rat   185 EVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGME-GRDSCQADSGGPLVCR---WNCSWV 245

  Fly   232 LIGVTSYGKKSGC-TKGYPSVFTRITAYLDWI 262
            .:||.|:|  .|| ...:|.|:||:.:||.||
  Rat   246 QVGVVSWG--IGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/257 (30%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 80/258 (31%)
Tryp_SPc 33..275 CDD:214473 78/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.