DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG18420

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:126/282 - (44%) Gaps:41/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHG------IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWC 61
            :::||:.|.:.....|...||...|      :|.||..|::|..|..|:...|.......:   |
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFI---C 69

  Fly    62 GASLISDRYLLTAAHCVEKAVAITYYLGGVLR-----LAPRQLIRS-----TNPEVHLHPDWNCQ 116
            |.:|||.|.:||||||......|...||...|     ....|:.|:     .:|..|        
  Fly    70 GGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTH-------- 126

  Fly   117 SLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI-ASGWGRMNDESTAISDNLRYVY 180
              .|||||:||..:.:...:||||.:...:|.::..|.:..: .:||||  .||...|..||.:.
  Fly   127 --ANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGR--TESMHDSSELRTLD 187

  Fly   181 RFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNA--DILIGVTSYGKKSG 243
            ...:.::.|  ::.::.....|.. ....:.|.||:|||:......:||  .:.:|:....|:  
  Fly   188 ISRQPSKMC--AFGSVLSNQFCAG-NWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR-- 247

  Fly   244 CTKGYPSVFTRITAYLDWIGEV 265
            |.:  |||||.:.:::::|..:
  Fly   248 CQR--PSVFTDVMSHIEFIRRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/243 (28%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 67/243 (28%)
Tryp_SPc 43..267 CDD:238113 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.