DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG18636

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:297 Identity:85/297 - (28%)
Similarity:131/297 - (44%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGI------GGRIAGGELARANQFPYQVGLSIEEPNDMYCWC 61
            :..||:|.| |..|.| ..||...||      ..||..|..|:.|..|:.|.|  ....||:. |
  Fly    12 VGIILMFQL-LHSGCS-QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL--HSTTDMFV-C 71

  Fly    62 GASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTN--------PEVHL------HPD 112
            |.|||:|:.:||||||.   :|..:.   |.||...:..||..        .|.|:      |..
  Fly    72 GGSLITDKLVLTAAHCF---IANQHL---VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130

  Fly   113 WNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI-ASGWGRMNDESTAISDNL 176
            ::..:..||||::||.:..:..|:||||.:......|:..|.:..: |:|||:...||.  ||.|
  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD--SDAL 193

  Fly   177 --------------RYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPL--VYSDP 225
                          :::.:.:..|:.|..::              ..:.|.|||||||  |.:..
  Fly   194 QTLDIRRQPPDVCAKFIGQTIAGNQFCAGNW--------------DSNLCNGDSGGPLGAVITHK 244

  Fly   226 VQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            .....:.:|:.||..:: |.|.  ||||.:.::.::|
  Fly   245 NTQRFVQVGIASYTNRN-CQKA--SVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/261 (28%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/261 (28%)
Tryp_SPc 45..278 CDD:238113 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.