DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG33459

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:262 Identity:76/262 - (29%)
Similarity:110/262 - (41%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV---EKAVAITYYLGGVL 92
            ||.||..|.....|:...|.    |.:...||.|||:..::|||||||   .|.:.:        
  Fly    37 RIFGGMDAGLVSTPWMAFLH----NHLQFLCGGSLITSEFVLTAAHCVMPTPKNLTV-------- 89

  Fly    93 RLAPRQLIR---STNPE----------VHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPG 144
            ||......|   |.||:          ::.||.:. .....||||::|.:......:||||.|..
  Fly    90 RLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYR-SIAAYDIALLKLNQTVEYTVAIRPICLVL 153

  Fly   145 LSSSRNSYDYVPAI----ASGWGRMNDESTA---ISDNLRYVYRFVESNEDCEYSYA-NIKPTNI 201
            ..:....|..|.::    .:|||....|..:   .|.||..:.|     ..|...|. ::..|:|
  Fly   154 PENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDR-----GTCHDRYGHSVDHTHI 213

  Fly   202 CMDTTGGKS-TCTGDSGGPLVYSDPVQNADIL---IGVTSYGKKS--GCTKGYPSVFTRITAYLD 260
            |..::  || .|.||||.||... .|.|...:   :|:.|.|.|:  |.|     |||.:.::.:
  Fly   214 CAGSS--KSFACVGDSGSPLAMK-VVHNRRYIHAQVGIVSRGPKNCDGVT-----VFTNVVSFTE 270

  Fly   261 WI 262
            ||
  Fly   271 WI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/260 (28%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 74/260 (28%)
Tryp_SPc 38..272 CDD:238113 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.