DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG33462

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:267 Identity:67/267 - (25%)
Similarity:101/267 - (37%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DMG--HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAIT 85
            |.|  |.|..|....:||:.....|     :|.|...:  |..:||:..::|||||||...:.||
  Fly    28 DCGIPHNISERSVNAKLAQNPWMAY-----LETPKGFH--CSGTLINHLFVLTAAHCVPDDLLIT 85

  Fly    86 YYLGGVLRLAPRQLIRSTNPEV----HL---------------HPDWNCQSLENDIALVRLPEDA 131
            ..||..          :|..:|    ||               |..:|.....|||.::||....
  Fly    86 VRLGEY----------NTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRV 140

  Fly   132 LLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYA-N 195
            ...:.||||.:...:..:...|.:....:...| ...:.|.|..||.:....:..|.|...|. |
  Fly   141 EYLNHIRPICIFASNRFQEPIDQLTWFTTTVWR-ETAANATSKVLRTMNIDRQPKETCSEIYGWN 204

  Fly   196 IKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD--ILIGVTSYGKKSGCTKGYPSVFTRITAY 258
            :....||...|..: .|:.|||.|.:.......:|  :.:|:.|..|......|   :...:.:|
  Fly   205 MTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSG---ILMDLLSY 265

  Fly   259 LDWIGEV 265
            .|||..|
  Fly   266 ADWIKRV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 60/252 (24%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/245 (24%)
Tryp_SPc 48..269 CDD:214473 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.