DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:263 Identity:76/263 - (28%)
Similarity:128/263 - (48%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GR--SISCLDMG-HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHC 77
            ||  |:.|.:.| ..:..||.||:...:.::|:|..:.:...:.    ||||:::..:::|||||
  Rat   189 GRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSRHT----CGASVLAPYWVVTAAHC 249

  Fly    78 -----VEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSI 137
                 :.:..:...:.|.|...|.||...:...::..||.::.|:.:.|:||::|.......|::
  Rat   250 MYSFRLSRLSSWRVHAGLVSHSAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTV 314

  Fly   138 RPIRLPGLSS--SRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVES----NEDCEYSYANI 196
            ..:.||....  .:.|..:|    ||||..:...|..||.|:.....:.|    |..|.||.| :
  Rat   315 SAVCLPAKEQHFPQGSQCWV----SGWGHTDPSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGA-L 374

  Fly   197 KPTNICMDTTGGKS-TCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYL 259
            ....:|.....|:: .|.||||||||.  |..:...|:||.|:|:  ||.: ..|.|:.::..:|
  Rat   375 THRMLCAGYLDGRADACQGDSGGPLVC--PSGDTWHLVGVVSWGR--GCAEPNRPGVYAKVAEFL 435

  Fly   260 DWI 262
            |||
  Rat   436 DWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 69/243 (28%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 5/13 (38%)
Tryp_SPc 208..441 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.