DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and KLK13

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:253 Identity:70/253 - (27%)
Similarity:111/253 - (43%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG- 89
            :|..|.:.||.....:..|:|..|.::.    ...||..|:..:::||||||:::.:.:  ||| 
Human    30 NGTSGFLPGGYTCFPHSQPWQAALLVQG----RLLCGGVLVHPKWVLTAAHCLKEGLKV--YLGK 88

  Fly    90 -GVLRLAPRQLIRSTNPEVHL--HPDW--NCQSLENDIALVRLPEDALLCDSIRPIRLPG----- 144
             .:.|:...:.:|..   ||.  ||::  :...|.:|       .|.:|.:...|::|.|     
Human    89 HALGRVEAGEQVREV---VHSIPHPEYRRSPTHLNHD-------HDIMLLELQSPVQLTGYIQTL 143

  Fly   145 -LSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDT-T 206
             ||.:...........||||............|:.....:.|:|:|...| ..|....:|..| .
Human   144 PLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKE 208

  Fly   207 GGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGE 264
            |||.:|.||||||||.:      ..|.|:.|:|.........|.|:||::.|:.||.|
Human   209 GGKDSCEGDSGGPLVCN------RTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/244 (27%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.