DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss45

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:252 Identity:66/252 - (26%)
Similarity:112/252 - (44%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGG----------V 91
            |..::.:|::..|.||:.:    .||.:||...::::||||::.....:..||.          .
Mouse    55 LEESHHWPWEASLQIEDKH----VCGGALIDRSWVVSAAHCIQGNKEYSVMLGSSTLHPNGSSWT 115

  Fly    92 LRLAPRQLIRSTNPEVHLHPD-WNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDY- 154
            |::....:|        :||. |....:.:||||:.|.........::||.||     .::::: 
Mouse   116 LKIPVGDII--------IHPKYWGRNFIRSDIALLCLETPVTFNKYVQPICLP-----EHNFNFK 167

  Fly   155 --VPAIASGWGRMNDESTA---ISDNLRYVYRFVESNEDCE------YSYANIKP---TNICMDT 205
              .....:|||::...|:|   .:..|.....|:..|::|:      ..|..:.|   .|:...|
Mouse   168 VGTKCWVTGWGQVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTT 232

  Fly   206 TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            ..|:..|.||.||||...  :....||.||.|: :|:..|....||:||||.|..||
Mouse   233 NYGEDLCYGDPGGPLACE--IDGRWILAGVFSW-EKACATVPNLSVYTRITKYTIWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 64/250 (26%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 65/248 (26%)
Tryp_SPc 59..286 CDD:214473 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.