DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and KLK5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:299 Identity:78/299 - (26%)
Similarity:120/299 - (40%) Gaps:55/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLIL------VQGRSISC------------LDMGHGIG---------GRIAGGELA 38
            |.:...|:..|:|      :....:||            .|:|.|.|         .||..|...
Human     9 MWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDC 73

  Fly    39 RANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAP-----RQ 98
            ..:..|:|..|.: .||.:|  |||.|:..::|||||||.:|...:..   |...|:|     :|
Human    74 DMHTQPWQAALLL-RPNQLY--CGAVLVHPQWLLTAAHCRKKVFRVRL---GHYSLSPVYESGQQ 132

  Fly    99 LIRSTN--PEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASG 161
            :.:...  |    ||.::.....||:.|::|.........:|||.:.....|..:    ..:.||
Human   133 MFQGVKSIP----HPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGT----KCLVSG 189

  Fly   162 WGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDTTGGKSTCTGDSGGPLVYSDP 225
            ||............|:.:...|.|.:.||.:| ..|..|..|.....|:.:|.||||||:|.:..
Human   190 WGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGS 254

  Fly   226 VQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGE 264
            :|      |:.|:|.........|.|:|.:..:..||.|
Human   255 LQ------GLVSWGDYPCARPNRPGVYTNLCKFTKWIQE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/238 (27%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 5/30 (17%)
Tryp_SPc 66..285 CDD:214473 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.