DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG30287

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:297 Identity:86/297 - (28%)
Similarity:127/297 - (42%) Gaps:60/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGR----SISCLDMGHGIG-GRIAGGELARANQFPYQVGLSIEEPNDMYCW 60
            :|:..::..:.:.|||:    ...|:......| .|:..|:.|.....|:.| :.||..   ...
  Fly     6 VQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMV-IIIERG---MMK 66

  Fly    61 CGASLISDRYLLTAAHC----------------VEKAVAITYYLGGVLRLAPRQLIRSTNPEVHL 109
            ||.|||:.||:||||||                |.:||..:.| |.:.|  ||: |..|...|  
  Fly    67 CGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSY-GCIPR--PRE-INVTRTYV-- 125

  Fly   110 HPDWNCQSLENDIALVRLPEDALLCDSIRPIRL---PGLSSSRNSYDYVPAIASGWGRMN----- 166
             |.......:|||||:||.......|:||.|.|   ....||....:.|....:||||..     
  Fly   126 -PSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINS 189

  Fly   167 ---DESTAISDNLRYVYRFVESNEDCEYSYA-NIKPTNICMDTTGGKSTCTGDSGGPLVYSDPV- 226
               .:::....:|.|          |...:. .:..::||:.::.| |||.|||||||.....: 
  Fly   190 PVLQQASLTHHHLSY----------CAQVFGKQLDKSHICVASSTG-STCQGDSGGPLTARVRIG 243

  Fly   227 -QNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
             :...||.||.|||... |..  |:|:|.:..:.:||
  Fly   244 SERRVILFGVVSYGAVH-CFG--PTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/260 (30%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/260 (30%)
Tryp_SPc 42..280 CDD:238113 79/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.