DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG30187

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:268 Identity:83/268 - (30%)
Similarity:119/268 - (44%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVFLLILVQGRSISCLDM--GHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69
            ::|..:...|.|| .||.  |..|..:|.||..|......:...:.    |..:..||.:||..|
  Fly    10 VIFWFLKDVGASI-FLDQICGINIALKITGGHNAAFQNSVWMAAVH----NRTHFICGGTLIHKR 69

  Fly    70 YLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLC 134
            ::||||||:......:..||...:..|..........||...|... |.||||.|::|..|.:..
  Fly    70 FVLTAAHCIVDQDVQSVSLGAYNKSDPADRKDVITAVVHSSFDVRA-SYENDIGLLKLSSDVIFN 133

  Fly   135 DSIRPIRLPGLSSS-----RNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYA 194
            ..||||.:. |:.|     ||...:.   |.|||.:....|  ||.|:.:.......|:| |...
  Fly   134 ALIRPICIV-LNKSMANHMRNMRTFK---AFGWGTLRGNKT--SDILQTIILNHLDREEC-YMEL 191

  Fly   195 NIKPT--NICMDTTGGKSTCTGDSGGPL---VYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTR 254
            ::.|:  .||.....| .||.|||||||   |:...:.|.::..|:.|.||.|...:|   |:|.
  Fly   192 SVYPSEKQICAGVPSG-DTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQG---VYTD 252

  Fly   255 ITAYLDWI 262
            :.::.|||
  Fly   253 LMSFADWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/240 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 73/240 (30%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.