DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG30098

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:289 Identity:78/289 - (26%)
Similarity:120/289 - (41%) Gaps:72/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGR-------SISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGA 63
            :|.||:||..|.       ...|:.:   ...|:.||:.||  :.|:...|.    .|....||.
  Fly     7 LLTFLVILTLGSYGYSQLLDSKCIAL---FRIRVIGGQNAR--RTPWMAYLI----RDNRFACGG 62

  Fly    64 SLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPE--------VHLHPDWNCQSLEN 120
            |||:.|::||||||.:    |...|  .:||......|:|:.:        ::.|.:: .....:
  Fly    63 SLIAYRFVLTAAHCTK----INDNL--FVRLGEYDSSRTTDGQTRSYRVVSIYRHKNY-IDFRNH 120

  Fly   121 DIALVRLPEDALLCDSIRPIRL---PGLSSSRNSYDYVPAIASGWGRM----NDESTAISDNLRY 178
            |||:::|....:....||||.:   .||.|..||....  ..:|||:|    ...:|....:||.
  Fly   121 DIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF--TLTGWGQMAHYYKMPTTLQEMSLRR 183

  Fly   179 VYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPL----------VYSDPVQNADILI 233
            |     .||     |..:...:||. ....:..|.|||||||          :|        :..
  Fly   184 V-----RNE-----YCGVPSLSICC-WNPVQYACFGDSGGPLGSLVKYGHKTIY--------VQF 229

  Fly   234 GVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            |||:  ..:|...||.| :..:.:|:.|:
  Fly   230 GVTN--SVTGNCDGYSS-YLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/255 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 70/254 (28%)
Tryp_SPc 37..258 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.