DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG30090

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:267 Identity:79/267 - (29%)
Similarity:116/267 - (43%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL 92
            |..:|.||..|..|..|:...:.    :.:...||.:||:.|::|||||||.:..|:...||...
  Fly    36 IAFKIIGGRDAIINSNPWMAYIH----SSVKLICGGTLITQRFVLTAAHCVNEGSAVKVRLGEYD 96

  Fly    93 RLAPRQ------LIRSTNPEVHL---HPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSS 148
            ..|...      :.|:...:|.:   |..::.....|||||:||.:.......|.||.:...:|.
  Fly    97 DTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSK 161

  Fly   149 RNSYDYVP-AIASGWGRMNDEST----AISDNLRYVYRFVESNEDCEYSYANIKPTN-ICMDTTG 207
            |...|.:. .:|:|||......|    .|:...||      ::..|..:...:...| ||.... 
  Fly   162 RELVDSIEWFVATGWGETRTHRTRGVLQITQLQRY------NSSQCMQALGRLVQQNQICAGRL- 219

  Fly   208 GKSTCTGDSGGPLVYSDPVQNAD----ILIGVTSYGKK--SGCTKGYPSVFTRITAYLDWIGEV- 265
            |..||.|||||||..:  |::.|    :..||.|||.:  ||.     .|:|.:.:|.|||..| 
  Fly   220 GSDTCNGDSGGPLFQT--VRHMDKMRPVQFGVVSYGSRECSGI-----GVYTDVYSYADWIATVV 277

  Fly   266 -SGVHYP 271
             ...|.|
  Fly   278 QQNTHVP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/251 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 73/251 (29%)
Tryp_SPc 40..276 CDD:238113 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.