DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG30087

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:263 Identity:70/263 - (26%)
Similarity:108/263 - (41%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            |:..|:.|.....|:.|.::    |:....||.|:::.||:|||||||...:.        |||.
  Fly    41 RVVNGKEAVIRSAPFMVYVT----NNSLTHCGGSILNSRYILTAAHCVFPNLR--------LRLG 93

  Fly    96 PRQLIRSTNPEVH-----------------LHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL- 142
            ...:  .|:|:..                 .|..:|..:..|||||::|.........|:||.: 
  Fly    94 EHNI--RTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICIL 156

  Fly   143 --PGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNE-DCEYS----YANIKPTN 200
              |..:.|..:|.     ..|||...      .:...::.:..|... |..|.    :|.:....
  Fly   157 LNPASAPSVATYQ-----TFGWGETK------KNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQ 210

  Fly   201 ICMDTTGG---KSTCTGDSGGPLVYS---DPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYL 259
            ||    .|   :.||.||||||||..   |.|:.. :.:|:.||| .:.|..  |.|:|.:..|:
  Fly   211 IC----AGHEERDTCAGDSGGPLVTRVDFDGVKRY-LQLGIVSYG-PTDCQS--PGVYTYVPNYI 267

  Fly   260 DWI 262
            :||
  Fly   268 NWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/261 (26%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 68/261 (26%)
Tryp_SPc 42..272 CDD:238113 69/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.