DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG30083

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:292 Identity:80/292 - (27%)
Similarity:128/292 - (43%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISCLDMGHG---IGGRIAGGELARANQFPYQVGLSIEEPND---MYC 59
            |.|.||.. :::|..|.....|:...|   |..:|..|:.|.....|:..  .|.:.||   ...
  Fly     1 MFIFTIFK-IILLWPGAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMA--YIFKYNDKEVAEL 62

  Fly    60 WCGASLISDRYLLTAAHCVEKAVAITYYLGG-------VLRLAPRQLIRSTNPEVHLHPDWNCQS 117
            .||.:||..:::|:||||:::...:...||.       .:..|.|....:|.            |
  Fly    63 VCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFRNKYFTTG------------S 115

  Fly   118 LENDIALVRLPEDALLCDSIRPI-------RLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDN 175
            ..|||.::|:.........||||       ::|.:.:.:         |:|||:..:|:      
  Fly   116 YSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK---------AAGWGKTENET------ 165

  Fly   176 LRYVYRFVESNE----DCEYS--YANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADIL-- 232
            ...|.:.||.||    :| |:  :.|:..:.||.....| .||.|||||||::  ||.....|  
  Fly   166 FSKVLKTVELNELNASEC-YNMLWVNVTESQICAGHPDG-DTCAGDSGGPLIH--PVYMDGSLRY 226

  Fly   233 --IGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
              :|:.|:| .|.|..  |.|:||:::::|||
  Fly   227 VQLGIISFG-SSLCNS--PGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 69/257 (27%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 69/257 (27%)
Tryp_SPc 34..255 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.