DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG30002

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:258 Identity:75/258 - (29%)
Similarity:117/258 - (45%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVE---KAVAITYYLGGVLR 93
            |.||..:.....|:...|.|....:| |.||.||||:.::||||||.:   ::..|..:| |.|.
  Fly    62 ITGGRKSSLMSQPWMAFLHIASDLEM-CRCGGSLISELFVLTAAHCFKMCPRSKEIRVWL-GELD 124

  Fly    94 LAPRQLIRSTN------PEVH--------LHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPG 144
            |:......:.|      |.|.        ||.::|......||||::|.:..:..|.||||.|| 
  Fly   125 LSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLP- 188

  Fly   145 LSSSRNSYDYVPA---IASGWGRMNDESTAISDNLRYVYRFVE---SNEDCEYSYANIKPTNICM 203
            |:....::.....   :|.|||:        :::|||....:|   ..|.|    .:.:.|:...
  Fly   189 LTDELLAFTLQLGQRFMAVGWGK--------TESLRYANSTMEVDIRTEKC----TDGRDTSFLC 241

  Fly   204 DTTGGKSTCTGDSGGPLVYSDPVQNAD--ILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGE 264
            .:.....||.|||||||::...:...|  :..||.|.|.:: |..|:.:.:..:..|:.||.|
  Fly   242 ASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQN-CGAGHKAYYMDVPTYMPWILE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/254 (28%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 72/254 (28%)
Tryp_SPc 62..301 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.