DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1b3

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:292 Identity:83/292 - (28%)
Similarity:128/292 - (43%) Gaps:66/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW----CGASLI 66
            :.::.|||....|:...|....:..|:.||.....|..|:||.        :|.:    ||..||
  Rat     3 VTMWFLILFLALSLGRNDAAPPVQSRVVGGYNCEMNSQPWQVA--------VYYFGEYLCGGVLI 59

  Fly    67 SDRYLLTAAHCVEKAVAITYYLGGVLR--------LAPRQLIRSTNPEVHLHPDWNCQSL----- 118
            ...:::|||||......:  :||   |        .|..:|:..:.|    ||.:| |.|     
  Rat    60 DPSWVITAAHCATDNYQV--WLG---RNNLYEDEPFAQHRLVSQSFP----HPGFN-QDLIWNHT 114

  Fly   119 -------ENDIALVRLPEDALLCDSIR----PIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAI 172
                   .||:.|:.|.:.|.:.|.::    ||..|.:.|:        .:|||||.:..:...:
  Rat   115 RQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIEEPKVGST--------CLASGWGSITPDGLEL 171

  Fly   173 SDNLRYVYRFVESNEDC-EYSYANIKPTNIC---MDTTGGKSTCTGDSGGPLVYSDPVQNADILI 233
            ||:|:.|...:.|||.| |.....:....:|   ||  |||.||.|||||||:.:      .:|.
  Rat   172 SDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMD--GGKDTCKGDSGGPLICN------GVLQ 228

  Fly   234 GVTSYGKKSGCTKGYPSVFTRITAYLDWIGEV 265
            |:||:|.........|.::|::..:..||.||
  Rat   229 GITSWGFNPCGEPKKPGIYTKLIKFTPWIKEV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/262 (28%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 74/262 (28%)
Tryp_SPc 29..260 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.